- Recombinant Rhizobium sp. Uncharacterized protein y4bH (NGR_a00220)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1037417
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,641 Da
- E Coli or Yeast
- 33239
- NGR234_28
- Uncharacterized protein y4bH (NGR_a00220)
Sequence
MHYRSQRRSVLFTAPGLIVGALAIGAAGGISVSPGDILALVEKPHLLVAVLFVGAFTGIMVEQALSRMRRQDGARGTARAGRNSARRRMPS